(data stored in ACNUC7421 zone)

EMBL: AM286690.PE282

AM286690.PE282       Location/Qualifiers
FT   CDS             307384..308883
FT                   /transl_table=11
FT                   /locus_tag="ABO_0282"
FT                   /product="monooxygenase, flavin-binding family"
FT                   /note="monooxygenase flavin-binding family identified by
FT                   sequence similarity; putative InterPro: Flavin-containing
FT                   monooxygenase (FMO)"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15730"
FT                   /db_xref="GOA:Q0VSW8"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSW8"
FT                   /protein_id="CAL15730.1"
FT                   /translation="MSNKHVDVLIVGAGLSGIGAACHLTRKAPNRTYAILERRERIGGT
FT                   WDLFKYPGIRSDSDMFTLGYNFRPWTEPKVLADGNSIRQYVEDTAEEYDVKKHIRFGRK
FT                   VIKANWSSADNHWAVETTNEKTGEQETFTANFLFSCGGYYNYDEGYKPDFPGEKDFKGQ
FT                   VIHPQHWPENLDYKGKKVVVIGSGATAVTLVPAMAKEGAKVTMLQRSPTYIATVPEVDQ
FT                   ISVGMRRFMPEMMVYRLTRARNIGLQRMVFKLSTQRPKLVRRALLAAAKRQLGDDVDMA
FT                   HFRPHYNPWDERLCAVPNGDLFKTVRNGDAEIVTDHIERFTETGILLKSGKELDADIII
FT                   TATGLNLQMLGGVKSTIDGKPVEPRESLVYKGMMLRDVPNMALVFGYTNSSWTLKADLV
FT                   CEYVCRLLNHMEKTGAQTVIPRDKDNCITDDNFLGMQSGYIQRANDRLPRQGSKEPWKV
FT                   VQNYMVDLPKLRLGAIDDGFLEFDNYQPVKKKGLVASLLGA"
     MSNKHVDVLI VGAGLSGIGA ACHLTRKAPN RTYAILERRE RIGGTWDLFK YPGIRSDSDM        60
     FTLGYNFRPW TEPKVLADGN SIRQYVEDTA EEYDVKKHIR FGRKVIKANW SSADNHWAVE       120
     TTNEKTGEQE TFTANFLFSC GGYYNYDEGY KPDFPGEKDF KGQVIHPQHW PENLDYKGKK       180
     VVVIGSGATA VTLVPAMAKE GAKVTMLQRS PTYIATVPEV DQISVGMRRF MPEMMVYRLT       240
     RARNIGLQRM VFKLSTQRPK LVRRALLAAA KRQLGDDVDM AHFRPHYNPW DERLCAVPNG       300
     DLFKTVRNGD AEIVTDHIER FTETGILLKS GKELDADIII TATGLNLQML GGVKSTIDGK       360
     PVEPRESLVY KGMMLRDVPN MALVFGYTNS SWTLKADLVC EYVCRLLNHM EKTGAQTVIP       420
     RDKDNCITDD NFLGMQSGYI QRANDRLPRQ GSKEPWKVVQ NYMVDLPKLR LGAIDDGFLE       480
     FDNYQPVKKK GLVASLLGA                                                    499
//

If you have problems or comments...

PBIL Back to PBIL home page