(data stored in ACNUC7421 zone)

EMBL: AM286690.PE283

AM286690.PE283       Location/Qualifiers
FT   CDS             complement(309077..310042)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0283"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15731"
FT                   /db_xref="GOA:Q0VSW7"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSW7"
FT                   /protein_id="CAL15731.1"
FT                   /translation="MALPASLQNSLQLPVVASPMFIVSNPELVIAQCKAGIVGSFPALN
FT                   ARPAEELEVWLKRITEELDAWNQANPDKPAAPFAVNQIVHRSNNRLEHDLELCVKYKVP
FT                   IVITSLGARVDVNEAIHSYGGLVFHDIINNFFAKKAIEKGADGLIAVAAGAGGHAGTLS
FT                   PLALVQEIREWFDGPLLLSGAIATGDAVLAAQAMGADLGYIGSAFIATDEANADERYKQ
FT                   AIVDSGASDIVYSNLFTGVHGNYLRGSIEAAGLDPENLPESDPSKMDFGDGSSKAWKDI
FT                   WGSGQGIGAVKKIGPAADLVDRLKREYSAARQRINALPWK"
     MALPASLQNS LQLPVVASPM FIVSNPELVI AQCKAGIVGS FPALNARPAE ELEVWLKRIT        60
     EELDAWNQAN PDKPAAPFAV NQIVHRSNNR LEHDLELCVK YKVPIVITSL GARVDVNEAI       120
     HSYGGLVFHD IINNFFAKKA IEKGADGLIA VAAGAGGHAG TLSPLALVQE IREWFDGPLL       180
     LSGAIATGDA VLAAQAMGAD LGYIGSAFIA TDEANADERY KQAIVDSGAS DIVYSNLFTG       240
     VHGNYLRGSI EAAGLDPENL PESDPSKMDF GDGSSKAWKD IWGSGQGIGA VKKIGPAADL       300
     VDRLKREYSA ARQRINALPW K                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page