(data stored in ACNUC7421 zone)

EMBL: AM286690.PE284

AM286690.PE284       Location/Qualifiers
FT   CDS             complement(310198..310692)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15732"
FT                   /db_xref="GOA:Q0VSW6"
FT                   /db_xref="InterPro:IPR025557"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSW6"
FT                   /protein_id="CAL15732.1"
FT                   /translation="MQTPKSETPPPGPPPRIPNLADWRFNRYLTMQLMPLFYLLLIAGA
FT                   LIVVVSVVGLCFWFSTLAGIIAAVIAPLAFVVMVAVIRAALEYMIMAHRIMRIIERMDA
FT                   LPGQVADLSVRVDGITNHVDELSGHVTDIHETLMHARPLLRSAGLPSRLLNALRRRTPD
FT                   A"
     MQTPKSETPP PGPPPRIPNL ADWRFNRYLT MQLMPLFYLL LIAGALIVVV SVVGLCFWFS        60
     TLAGIIAAVI APLAFVVMVA VIRAALEYMI MAHRIMRIIE RMDALPGQVA DLSVRVDGIT       120
     NHVDELSGHV TDIHETLMHA RPLLRSAGLP SRLLNALRRR TPDA                        164
//

If you have problems or comments...

PBIL Back to PBIL home page