(data stored in ACNUC7421 zone)

EMBL: AM286690.PE286

AM286690.PE286       Location/Qualifiers
FT   CDS             311482..312315
FT                   /transl_table=11
FT                   /locus_tag="ABO_0286"
FT                   /product="oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /note="oxidoreductase (short chaindehydrogenase/reductase
FT                   family) identified by match to TIGR protein family
FT                   HMMTIGR01500 InterPro: Short-chain dehydrogenase/reductase
FT                   (SDR) superfamily"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15734"
FT                   /db_xref="GOA:Q0VSW4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSW4"
FT                   /inference="protein motif:HMMTIGR:HMMTIGR01500"
FT                   /protein_id="CAL15734.1"
FT                   /translation="MFGRNKTISANASAVVTGAGSGIGRAFAEELARRNGAVVCADINL
FT                   GTAQETADRIVSTGGRAWAVQCDVSVQAEVEALAEQADALLPEPVNLVINNAGVGVGGK
FT                   PVGETSMDDWHWTMGINLWGVIHGCHVFAPRLKAQGYGGIINVASTASFAAAPLMGPYN
FT                   VTKAGVLALSETLAAETSGTGVNVTVLCPTVVNTNIFTTGRIDAGITPLMNRLVELTGV
FT                   PAEGVALTTLKALDRGQLYVLPQMDARMIWRAKRYLPSVYTRGAGLLSRLASAKA"
     MFGRNKTISA NASAVVTGAG SGIGRAFAEE LARRNGAVVC ADINLGTAQE TADRIVSTGG        60
     RAWAVQCDVS VQAEVEALAE QADALLPEPV NLVINNAGVG VGGKPVGETS MDDWHWTMGI       120
     NLWGVIHGCH VFAPRLKAQG YGGIINVAST ASFAAAPLMG PYNVTKAGVL ALSETLAAET       180
     SGTGVNVTVL CPTVVNTNIF TTGRIDAGIT PLMNRLVELT GVPAEGVALT TLKALDRGQL       240
     YVLPQMDARM IWRAKRYLPS VYTRGAGLLS RLASAKA                                277
//

If you have problems or comments...

PBIL Back to PBIL home page