(data stored in ACNUC7421 zone)

EMBL: AM286690.PE287

AM286690.PE287       Location/Qualifiers
FT   CDS             312369..313295
FT                   /transl_table=11
FT                   /locus_tag="ABO_0287"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15735"
FT                   /db_xref="GOA:Q0VSW3"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSW3"
FT                   /protein_id="CAL15735.1"
FT                   /translation="MASIDLEKMLAKIQSTQWALSDIDWDAPGAELITEEQWPKLKAFM
FT                   ADVMWIEHVGARAFAAMAKKAPTETLRQIYTYFHAEEQRHANVEMALMKRWGMLEGEGI
FT                   PEPNINLRLAIEWLDRYSDEMPIYVLGTMVPMLEIALDGALCTFLLETVKDPICHQAFE
FT                   KINDDESRHLGVGFSVMEMQGRGKTFIGAAKMLAPLLNPRLLLGMASYLPLLNKMRDNI
FT                   IGMGLPEERLYAAMAKFETIGGRTEDGRRNPWYQLVRHHAKLMVDRNKRVYHVPVDGLV
FT                   KLTGMIPPRMLPAVPSWVNELTYHPIA"
     MASIDLEKML AKIQSTQWAL SDIDWDAPGA ELITEEQWPK LKAFMADVMW IEHVGARAFA        60
     AMAKKAPTET LRQIYTYFHA EEQRHANVEM ALMKRWGMLE GEGIPEPNIN LRLAIEWLDR       120
     YSDEMPIYVL GTMVPMLEIA LDGALCTFLL ETVKDPICHQ AFEKINDDES RHLGVGFSVM       180
     EMQGRGKTFI GAAKMLAPLL NPRLLLGMAS YLPLLNKMRD NIIGMGLPEE RLYAAMAKFE       240
     TIGGRTEDGR RNPWYQLVRH HAKLMVDRNK RVYHVPVDGL VKLTGMIPPR MLPAVPSWVN       300
     ELTYHPIA                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page