(data stored in ACNUC7421 zone)

EMBL: AM286690.PE29

AM286690.PE29        Location/Qualifiers
FT   CDS             31494..32021
FT                   /transl_table=11
FT                   /locus_tag="ABO_0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15477"
FT                   /db_xref="InterPro:IPR025411"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTN1"
FT                   /protein_id="CAL15477.1"
FT                   /translation="MQRLMIPRFLVLASALLLSACVSPVVIDSQPDANLAQYQTYAFVS
FT                   QAEDGPRELDDQRTLAALEKALAAEGMTEVDADQADVQVKYFFKREQRFDGSSVQFGFG
FT                   FTRNNVGLGASTPTEGEISDEYKLVVQLIDPQNRNVVWQATSRDKMHDEMSSERRNTYI
FT                   QKAVEEMFKQYP"
     MQRLMIPRFL VLASALLLSA CVSPVVIDSQ PDANLAQYQT YAFVSQAEDG PRELDDQRTL        60
     AALEKALAAE GMTEVDADQA DVQVKYFFKR EQRFDGSSVQ FGFGFTRNNV GLGASTPTEG       120
     EISDEYKLVV QLIDPQNRNV VWQATSRDKM HDEMSSERRN TYIQKAVEEM FKQYP            175
//

If you have problems or comments...

PBIL Back to PBIL home page