(data stored in ACNUC7421 zone)

EMBL: AM286690.PE292

AM286690.PE292       Location/Qualifiers
FT   CDS             319391..320188
FT                   /transl_table=11
FT                   /locus_tag="ABO_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15740"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSV8"
FT                   /protein_id="CAL15740.1"
FT                   /translation="MTIKSTLIGLATGLLALLAVGSCSNDGKQAYLQQQVRQTLQDNNL
FT                   SVWRVDTLTVTGRNEEGHEDHSATHYLFDVALLLQEDLQRVRYADADTRELVVTAGARA
FT                   GERAVLPGVAKIEGEQTGLFDKDDVTQARISLSLTDLPAGLPASLLRQRFADWQQITVG
FT                   SDAYQSLLNRLRRLLLDEQRALIDVSDRLRRARQQLSVQDEELRELEERAQQSSEMGEP
FT                   MERASEGIEALMARVDQLQVEQYSQEEAVEKLRADLDHLQGVP"
     MTIKSTLIGL ATGLLALLAV GSCSNDGKQA YLQQQVRQTL QDNNLSVWRV DTLTVTGRNE        60
     EGHEDHSATH YLFDVALLLQ EDLQRVRYAD ADTRELVVTA GARAGERAVL PGVAKIEGEQ       120
     TGLFDKDDVT QARISLSLTD LPAGLPASLL RQRFADWQQI TVGSDAYQSL LNRLRRLLLD       180
     EQRALIDVSD RLRRARQQLS VQDEELRELE ERAQQSSEMG EPMERASEGI EALMARVDQL       240
     QVEQYSQEEA VEKLRADLDH LQGVP                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page