(data stored in ACNUC7421 zone)

EMBL: AM286690.PE293

AM286690.PE293       Location/Qualifiers
FT   CDS             320221..320676
FT                   /transl_table=11
FT                   /locus_tag="ABO_0293"
FT                   /product="conserved hypothetical protein"
FT                   /function="unknown"
FT                   /note="(conserved hypothetical protein )"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15741"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSV7"
FT                   /protein_id="CAL15741.1"
FT                   /translation="MGGYGYHGGFFPVLDSAMFEQTITPRFYETDAFGHVNNTVVTGWF
FT                   ETGRAPLFRLFGDAENPASMPLILARVEVDFVAQIYYGSDVILRAAIERIGNSSFVVIQ
FT                   QAWQNGALVARGRAVQVYFDHKTQASAPLPDDLRDALAQHEGELPES"
     MGGYGYHGGF FPVLDSAMFE QTITPRFYET DAFGHVNNTV VTGWFETGRA PLFRLFGDAE        60
     NPASMPLILA RVEVDFVAQI YYGSDVILRA AIERIGNSSF VVIQQAWQNG ALVARGRAVQ       120
     VYFDHKTQAS APLPDDLRDA LAQHEGELPE S                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page