(data stored in ACNUC7421 zone)

EMBL: AM286690.PE297

AM286690.PE297       Location/Qualifiers
FT   CDS             324130..325128
FT                   /transl_table=11
FT                   /locus_tag="ABO_0297"
FT                   /product="ABC transporter, ATP-binding protein, putative"
FT                   /note="(ABC transporter ATP-binding protein, putative)
FT                   identified by match to PFAM protein family HMMPF00005
FT                   InterPro: AAA ATPase superfamily"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15745"
FT                   /db_xref="GOA:Q0VSV3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSV3"
FT                   /inference="protein motif:HMMPFAM:HMMPF00005"
FT                   /protein_id="CAL15745.1"
FT                   /translation="MRVDAVVSIKNLHKTYQSGFQALKGVDLDIRAGEIFALLGPNGAG
FT                   KTTLISIICGIVNPSSGTVRAAGHDIISEFRAARSAIGLVPQEISTDAFETVWATVSFS
FT                   RGLFGKPRNDAHIEKVLKALSLWDKKDSKIITLSGGMKRRVMIAKALSHEPRILFLDEP
FT                   TAGVDVELRREMWEMVRQLREQGVTIILTTHYIEEAEEMADRVGIISKGEIILVDEKSR
FT                   LMEKLGRKQLIVHLSEPLTAVPDVLAGQELALADEGFSLVYSYDANQENTGIAELLRHL
FT                   NEQGIDFKDLHSRQSSLEDIFVDLVHNGKPGASPVSNGATSEKPNVPGDEK"
     MRVDAVVSIK NLHKTYQSGF QALKGVDLDI RAGEIFALLG PNGAGKTTLI SIICGIVNPS        60
     SGTVRAAGHD IISEFRAARS AIGLVPQEIS TDAFETVWAT VSFSRGLFGK PRNDAHIEKV       120
     LKALSLWDKK DSKIITLSGG MKRRVMIAKA LSHEPRILFL DEPTAGVDVE LRREMWEMVR       180
     QLREQGVTII LTTHYIEEAE EMADRVGIIS KGEIILVDEK SRLMEKLGRK QLIVHLSEPL       240
     TAVPDVLAGQ ELALADEGFS LVYSYDANQE NTGIAELLRH LNEQGIDFKD LHSRQSSLED       300
     IFVDLVHNGK PGASPVSNGA TSEKPNVPGD EK                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page