(data stored in ACNUC7421 zone)

EMBL: AM286690.PE30

AM286690.PE30        Location/Qualifiers
FT   CDS             complement(32005..33318)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0030"
FT                   /product="sensor histidine kinase"
FT                   /function="activates the flagella regulon by activating
FT                   transcription of flhdc. may activate qseb by
FT                   phosphorylation"
FT                   /EC_number="2.7.3.-"
FT                   /note="sensor histidine kinase identified by sequence
FT                   similarity; putative InterPro: Histidine kinase C-terminal"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15478"
FT                   /db_xref="GOA:Q0VTN0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTN0"
FT                   /protein_id="CAL15478.1"
FT                   /translation="MMARSLRSRVLWLVALSLLSVWLLLALWLHNTVKQHLGTALDQRL
FT                   AASARMVASMANASAPVLSGNPGLQAAVNSGLFCQVMNVRGEILARSGGAPTAHLASAQ
FT                   DGFTERSLEGERWRVYTVSEGQIRVATAEPMAVRESLLSTLAWALLVGLLLALLGAWLA
FT                   VRWAVSRGLAPLDAMRKEFESRPVQTKSGVASSAAGITELMPLVTALDGWADQARQALL
FT                   RERRLTDDLAHELRTPLAALKTQLQVARLKMAPDAPAMMALTAAENASSRMADNLQQLL
FT                   ALARLDGLPQSRPRLVRKVIDESLAQLAGHPQRQAVQRDDQACAGITLAAPSLASLALR
FT                   NLLENALRYTPKGKEVWIRVVANTRELHIHVEDQGPGISDNQAVVCARGHRGDRGQTGL
FT                   GLAIVATVMARSGGQLTLHNRAGGGLCATLSWPLTDTA"
     MMARSLRSRV LWLVALSLLS VWLLLALWLH NTVKQHLGTA LDQRLAASAR MVASMANASA        60
     PVLSGNPGLQ AAVNSGLFCQ VMNVRGEILA RSGGAPTAHL ASAQDGFTER SLEGERWRVY       120
     TVSEGQIRVA TAEPMAVRES LLSTLAWALL VGLLLALLGA WLAVRWAVSR GLAPLDAMRK       180
     EFESRPVQTK SGVASSAAGI TELMPLVTAL DGWADQARQA LLRERRLTDD LAHELRTPLA       240
     ALKTQLQVAR LKMAPDAPAM MALTAAENAS SRMADNLQQL LALARLDGLP QSRPRLVRKV       300
     IDESLAQLAG HPQRQAVQRD DQACAGITLA APSLASLALR NLLENALRYT PKGKEVWIRV       360
     VANTRELHIH VEDQGPGISD NQAVVCARGH RGDRGQTGLG LAIVATVMAR SGGQLTLHNR       420
     AGGGLCATLS WPLTDTA                                                      437
//

If you have problems or comments...

PBIL Back to PBIL home page