(data stored in ACNUC7421 zone)

EMBL: AM286690.PE300

AM286690.PE300       Location/Qualifiers
FT   CDS             complement(327151..328380)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15748"
FT                   /db_xref="GOA:Q0VSV0"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSV0"
FT                   /protein_id="CAL15748.1"
FT                   /translation="MSDSQFDVVVFGASSFVGQILCQYLFDTYGANGELKWAAAGRSQN
FT                   KLKRVKASLGDGASTLPLIIANANDADSLDALCAQTRVVVSTVGPYALYGEPMIKACVN
FT                   SGTDYCDLTGEAQWIAEMLEKYETTAKKNGARIVHCCGFDSIPSDMGVYFLQQQSQARF
FT                   NAPASTVHMRVKVAKGGVSGGTVASMMNIAEEAGKDPALRKKLADPYLLCPPDHGFKSR
FT                   QNSIGLASYDNDFNAWVGPFVMDAINSRVVHRSNALSGKAYSDHFIYSEAMLTGNDMGG
FT                   RMKALGIGVGTGLFFVAAAVKPTRWVLNTFVMPQPGEGPSPEAQKAGFYDIRFVGHTDN
FT                   SETLKVKVTGDADPGYGSTAKLLGQAAACLAQDVAEDAPGGFWTTATLLGEPLLKRLQD
FT                   NAGMTFTVID"
     MSDSQFDVVV FGASSFVGQI LCQYLFDTYG ANGELKWAAA GRSQNKLKRV KASLGDGAST        60
     LPLIIANAND ADSLDALCAQ TRVVVSTVGP YALYGEPMIK ACVNSGTDYC DLTGEAQWIA       120
     EMLEKYETTA KKNGARIVHC CGFDSIPSDM GVYFLQQQSQ ARFNAPASTV HMRVKVAKGG       180
     VSGGTVASMM NIAEEAGKDP ALRKKLADPY LLCPPDHGFK SRQNSIGLAS YDNDFNAWVG       240
     PFVMDAINSR VVHRSNALSG KAYSDHFIYS EAMLTGNDMG GRMKALGIGV GTGLFFVAAA       300
     VKPTRWVLNT FVMPQPGEGP SPEAQKAGFY DIRFVGHTDN SETLKVKVTG DADPGYGSTA       360
     KLLGQAAACL AQDVAEDAPG GFWTTATLLG EPLLKRLQDN AGMTFTVID                   409
//

If you have problems or comments...

PBIL Back to PBIL home page