(data stored in ACNUC7421 zone)

EMBL: AM286690.PE301

AM286690.PE301       Location/Qualifiers
FT   CDS             complement(328635..329075)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0301"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15749"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSU9"
FT                   /protein_id="CAL15749.1"
FT                   /translation="MSACPCQSGLDYRQCCQPLHEGKPAPSPQALMRSRFCAFALNNTA
FT                   YLTSSWHHSQRPATLTLDSDEQWLALEILHCDTDGDTGTVHFRATSQHRQGLSVLEENS
FT                   RFVKENGHWFYLDGTPKSSVLKLGRNDPCPCGSSRKFKKCCG"
     MSACPCQSGL DYRQCCQPLH EGKPAPSPQA LMRSRFCAFA LNNTAYLTSS WHHSQRPATL        60
     TLDSDEQWLA LEILHCDTDG DTGTVHFRAT SQHRQGLSVL EENSRFVKEN GHWFYLDGTP       120
     KSSVLKLGRN DPCPCGSSRK FKKCCG                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page