(data stored in ACNUC7421 zone)

EMBL: AM286690.PE303

AM286690.PE303       Location/Qualifiers
FT   CDS             complement(330883..332382)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15751"
FT                   /db_xref="InterPro:IPR041223"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSU7"
FT                   /protein_id="CAL15751.1"
FT                   /translation="MKYMAYSLSFKENALTSVRILSTHKAWKPWGMRITNPISKSGFFW
FT                   LPSTPDHKIPGEITISNGGKVEIETIGHFRNSPTQLAQILAGNHDGEARIHGHVQEFGD
FT                   VTVDDCIYTNQTLSTLGGTTLSARNAYLGALISEKEPPLFDSVDFSFDGLNEWARQTSL
FT                   SQSRSEDRNEISITYKKPENIDLRIGEGVSLHIIYDYSSSGSPGTRTLKSTTSLRLSFE
FT                   EATNIEEAIRLIHRIQNFFSFAMDETTHLLQINGTHEKYIIQHANNRETLKPIKIFYHG
FT                   AYDPGTESPSILAPSMLFHLRLVKETLEKNLTEWLRYYEVITPTLNLYFSQKSGAYRFL
FT                   NGRFLALAQAIETLHRNTSNEKFMDEAAFKDIRRQIITGCPEAFRGRLSPMLIHGNELS
FT                   LKERLERVIDPHSKYFGGNENVETLIKMIKDNRNYLTHYDRALENKLLDGPKLYAVCLK
FT                   IEAILQIKFMELIGFEESLLDQIIERSHAIANKLRPTLTDS"
     MKYMAYSLSF KENALTSVRI LSTHKAWKPW GMRITNPISK SGFFWLPSTP DHKIPGEITI        60
     SNGGKVEIET IGHFRNSPTQ LAQILAGNHD GEARIHGHVQ EFGDVTVDDC IYTNQTLSTL       120
     GGTTLSARNA YLGALISEKE PPLFDSVDFS FDGLNEWARQ TSLSQSRSED RNEISITYKK       180
     PENIDLRIGE GVSLHIIYDY SSSGSPGTRT LKSTTSLRLS FEEATNIEEA IRLIHRIQNF       240
     FSFAMDETTH LLQINGTHEK YIIQHANNRE TLKPIKIFYH GAYDPGTESP SILAPSMLFH       300
     LRLVKETLEK NLTEWLRYYE VITPTLNLYF SQKSGAYRFL NGRFLALAQA IETLHRNTSN       360
     EKFMDEAAFK DIRRQIITGC PEAFRGRLSP MLIHGNELSL KERLERVIDP HSKYFGGNEN       420
     VETLIKMIKD NRNYLTHYDR ALENKLLDGP KLYAVCLKIE AILQIKFMEL IGFEESLLDQ       480
     IIERSHAIAN KLRPTLTDS                                                    499
//

If you have problems or comments...

PBIL Back to PBIL home page