(data stored in ACNUC7421 zone)

EMBL: AM286690.PE307

AM286690.PE307       Location/Qualifiers
FT   CDS             335737..336051
FT                   /transl_table=11
FT                   /locus_tag="ABO_0307"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15755"
FT                   /db_xref="InterPro:IPR005346"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR037021"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSU3"
FT                   /protein_id="CAL15755.1"
FT                   /translation="MSETMIHVEVVYALPQKQRLIGLDVPDGTSMLDAAKLSGIGEQFA
FT                   DLDLDKAPMGVFGKVVANPAGHILKPGERVEIYRPLTADPKLNRKRRAKEKASAGKASN
FT                   "
     MSETMIHVEV VYALPQKQRL IGLDVPDGTS MLDAAKLSGI GEQFADLDLD KAPMGVFGKV        60
     VANPAGHILK PGERVEIYRP LTADPKLNRK RRAKEKASAG KASN                        104
//

If you have problems or comments...

PBIL Back to PBIL home page