(data stored in ACNUC7421 zone)

EMBL: AM286690.PE311

AM286690.PE311       Location/Qualifiers
FT   CDS             complement(338834..339361)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15759"
FT                   /db_xref="GOA:Q0VST9"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VST9"
FT                   /protein_id="CAL15759.1"
FT                   /translation="MTGETPSNPYQTPDSITQKPNNPGAPELASRLYRFLGAIIDGLVQ
FT                   MVIIGPIIYFSGIWDAMMQSSGTISLTTSIGLFIAGELIFLALQGWLLFNRQQTIGKAL
FT                   LDMRIVGMEQDSVPAGKLYGLRYFVFHVLAQLPGINLIMLIDPLLIFRSDRRCLHDHLA
FT                   GTQVIQTQRTTT"
     MTGETPSNPY QTPDSITQKP NNPGAPELAS RLYRFLGAII DGLVQMVIIG PIIYFSGIWD        60
     AMMQSSGTIS LTTSIGLFIA GELIFLALQG WLLFNRQQTI GKALLDMRIV GMEQDSVPAG       120
     KLYGLRYFVF HVLAQLPGIN LIMLIDPLLI FRSDRRCLHD HLAGTQVIQT QRTTT            175
//

If you have problems or comments...

PBIL Back to PBIL home page