(data stored in ACNUC7421 zone)

EMBL: AM286690.PE327

AM286690.PE327       Location/Qualifiers
FT   CDS             358171..358716
FT                   /transl_table=11
FT                   /locus_tag="ABO_0327"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15775"
FT                   /db_xref="GOA:Q0VSS3"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSS3"
FT                   /protein_id="CAL15775.1"
FT                   /translation="MGGGSAVVAGNAAITVHPRAHFLFVPAERFMSKRTEQLTELLAPV
FT                   VEDLGFVLWGVEYIQGRGAVLRVFIDHADGISVDDCAAVSHEVSGVLDVEDPIPGEFNL
FT                   EVSSPGMDRPMFDITQYVDYIGEDVQLKLLAPVSGKRKMTAAIVAVDGDTLVVELDGET
FT                   LRVPYSQVDRARLQPRFN"
     MGGGSAVVAG NAAITVHPRA HFLFVPAERF MSKRTEQLTE LLAPVVEDLG FVLWGVEYIQ        60
     GRGAVLRVFI DHADGISVDD CAAVSHEVSG VLDVEDPIPG EFNLEVSSPG MDRPMFDITQ       120
     YVDYIGEDVQ LKLLAPVSGK RKMTAAIVAV DGDTLVVELD GETLRVPYSQ VDRARLQPRF       180
     N                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page