(data stored in ACNUC7421 zone)

EMBL: AM286690.PE338

AM286690.PE338       Location/Qualifiers
FT   CDS             complement(372252..372953)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0338"
FT                   /product="Deoxynucleoside kinase"
FT                   /function="catalyses production of deoxynucleotide
FT                   5'-monophosphate from a deoxynucleoside"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by sequence similarity; putative
FT                   InterPro: Deoxynucleoside kinase"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15786"
FT                   /db_xref="GOA:Q0VSR2"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSR2"
FT                   /protein_id="CAL15786.1"
FT                   /translation="MHSSTELTLTERIEQRRQAGTLPRFIAVEGPIGAGKTSLAKRLAM
FT                   TFGYDLLLEQADDNPFLTRFYQDPTRYALQTELFFLFQRADQLRQVQQQDLFAGPRIAD
FT                   FLIDKNRLFAQVTLDEDEFQLYSNVDDHLTVDAPRPDLVIYLQAPSQVLRQRIGHRGNN
FT                   FEQGIASDYLDKLSNAYTEFFHFYDRAPLLIVNAAEIDLVNHDRDYQQLISELLDIRSG
FT                   RHYFNPRPLVG"
     MHSSTELTLT ERIEQRRQAG TLPRFIAVEG PIGAGKTSLA KRLAMTFGYD LLLEQADDNP        60
     FLTRFYQDPT RYALQTELFF LFQRADQLRQ VQQQDLFAGP RIADFLIDKN RLFAQVTLDE       120
     DEFQLYSNVD DHLTVDAPRP DLVIYLQAPS QVLRQRIGHR GNNFEQGIAS DYLDKLSNAY       180
     TEFFHFYDRA PLLIVNAAEI DLVNHDRDYQ QLISELLDIR SGRHYFNPRP LVG              233
//

If you have problems or comments...

PBIL Back to PBIL home page