(data stored in ACNUC7421 zone)

EMBL: AM286690.PE348

AM286690.PE348       Location/Qualifiers
FT   CDS             complement(384361..385326)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to PFAM protein family
FT                   HMMPF01636"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15796"
FT                   /db_xref="GOA:Q0VSQ2"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSQ2"
FT                   /inference="protein motif:HMMPFAM:HMMPF01636"
FT                   /protein_id="CAL15796.1"
FT                   /translation="MSHPFDNLTPDYMLDAVDAAGFLSDGRLLQLNSFENRVYQVGQEE
FT                   GPPVIVKFYRPQRWSDEQILEEHAFSLFLAERDLPVVAPIEKGGTSLFHCDDFSFAVFR
FT                   RAGGHAPELANDDHLEQLGRTLARWHACGSDRPYTMRPTLQIVDDIRTASTFLCDDVVD
FT                   LNYRGQYRDVTGQILEKVAQQLNESAFPLLNVHGDCHTGNILWRPNADNQGGPHFVDLD
FT                   DSLRAPAMQDIWMLLSGDNDEQQHQLRVLARGYDTFLPFPWNQTRLIEPLRLRRIINYD
FT                   AWLAKRWDDPAFPPAFPWFESMNYWGNQVTLLQQQLQDLP"
     MSHPFDNLTP DYMLDAVDAA GFLSDGRLLQ LNSFENRVYQ VGQEEGPPVI VKFYRPQRWS        60
     DEQILEEHAF SLFLAERDLP VVAPIEKGGT SLFHCDDFSF AVFRRAGGHA PELANDDHLE       120
     QLGRTLARWH ACGSDRPYTM RPTLQIVDDI RTASTFLCDD VVDLNYRGQY RDVTGQILEK       180
     VAQQLNESAF PLLNVHGDCH TGNILWRPNA DNQGGPHFVD LDDSLRAPAM QDIWMLLSGD       240
     NDEQQHQLRV LARGYDTFLP FPWNQTRLIE PLRLRRIINY DAWLAKRWDD PAFPPAFPWF       300
     ESMNYWGNQV TLLQQQLQDL P                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page