(data stored in ACNUC7421 zone)

EMBL: AM286690.PE349

AM286690.PE349       Location/Qualifiers
FT   CDS             complement(385407..385739)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0349"
FT                   /product="Rieske 2Fe-2S family protein, putative"
FT                   /note="(Rieske 2Fe-2S family protein) identified by match
FT                   to PFAM protein family HMMPF00355 InterPro: Rieske
FT                   iron-sulfur protein 2Fe-2S subunit"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15797"
FT                   /db_xref="GOA:Q0VSQ1"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSQ1"
FT                   /inference="protein motif:HMMPFAM:HMMPF00355"
FT                   /protein_id="CAL15797.1"
FT                   /translation="MEHICNINDIEHESAREYQKDGQPVLVAKFDGQVHAYLNWCPHLG
FT                   IELNFMPDEFMDSDSQFIMCANHGALFEVETGNCLSGPCSGDKLIPVPLEVRGEEIWLG
FT                   EVPQPA"
     MEHICNINDI EHESAREYQK DGQPVLVAKF DGQVHAYLNW CPHLGIELNF MPDEFMDSDS        60
     QFIMCANHGA LFEVETGNCL SGPCSGDKLI PVPLEVRGEE IWLGEVPQPA                  110
//

If you have problems or comments...

PBIL Back to PBIL home page