(data stored in ACNUC7421 zone)

EMBL: AM286690.PE352

AM286690.PE352       Location/Qualifiers
FT   CDS             389467..389928
FT                   /transl_table=11
FT                   /locus_tag="ABO_0352"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15800"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSP8"
FT                   /protein_id="CAL15800.1"
FT                   /translation="MLFFHRLVRLCLLSVVMAGCAVKPVMHEPQQPMSASQELEGSPAL
FT                   SLLASAEQARQQGNSSRAERYLERALNIAPDSSWLYKELADLRLTEGDARGAEGFALKA
FT                   LRLAPEHPEYQAGLWELVATARDRQGDAGGAKAARERAAVLREPKPLEA"
     MLFFHRLVRL CLLSVVMAGC AVKPVMHEPQ QPMSASQELE GSPALSLLAS AEQARQQGNS        60
     SRAERYLERA LNIAPDSSWL YKELADLRLT EGDARGAEGF ALKALRLAPE HPEYQAGLWE       120
     LVATARDRQG DAGGAKAARE RAAVLREPKP LEA                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page