(data stored in ACNUC7421 zone)

EMBL: AM286690.PE357

AM286690.PE357       Location/Qualifiers
FT   CDS             complement(393384..393827)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0357"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15805"
FT                   /db_xref="GOA:Q0VSP3"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSP3"
FT                   /protein_id="CAL15805.1"
FT                   /translation="MQFALDYFLWIKAFHLIAMICWFAGIFYLPRLFVYHAMADDQPSR
FT                   ERFKIMERKLYRGIMNPSMIVTVVLGLWMFMTNIDAYKGSGWMHAKLALVFLLIGYHHV
FT                   CLSYMKKFAADANTKSDKFYRIFNEIPVFLLIAIVLLVIVKPF"
     MQFALDYFLW IKAFHLIAMI CWFAGIFYLP RLFVYHAMAD DQPSRERFKI MERKLYRGIM        60
     NPSMIVTVVL GLWMFMTNID AYKGSGWMHA KLALVFLLIG YHHVCLSYMK KFAADANTKS       120
     DKFYRIFNEI PVFLLIAIVL LVIVKPF                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page