(data stored in ACNUC7421 zone)

EMBL: AM286690.PE358

AM286690.PE358       Location/Qualifiers
FT   CDS             393943..395373
FT                   /transl_table=11
FT                   /locus_tag="ABO_0358"
FT                   /product="voltage-gated chloride channel family protein"
FT                   /note="identified by match to PFAM protein family
FT                   HMMPF00654 InterPro: Voltage gated chloride channels"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15806"
FT                   /db_xref="GOA:Q0VSP2"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSP2"
FT                   /inference="protein motif:HMMPFAM:HMMPF00654"
FT                   /protein_id="CAL15806.1"
FT                   /translation="MNKRPRHSRLMRYYLFRTRRLSRRQLGSWQDWKLRAVFWSGAVMV
FT                   GLLVVAFAWVAELASHTFTQIHARSPYLPVLITPVGMVVIVWLMRQLGTESQGSGIPQV
FT                   LVVLKQRYHWLRPAFLSLRVILSKFVLTCLGLLCGASIGREGPSVHMGAAMMYSVGRVG
FT                   QLNQKYVDNSLIVAGGAAGVSAAFNAPLAGIVFAIEELSGSFEQRTSGTLIMAIILSGV
FT                   VVLMIMGHYSFFGHPDGALDITRDWAAIGVTALVCGLLGGFFSRLLIKGSQFLSPYAKE
FT                   HPYRVVVLCALVVVFLGLITGGATYGSGYEQASTLLSGEQPGNWTFALAKMSATLVSYF
FT                   TGIPGGLFSPSLAAGAGVGNVVGGFFPGSSLVGVTLVAMAAFLAGVIQRPITSFVIVME
FT                   LTGNRHDILLPLMAGALLSAAVAKIVWPRPLYDSLADRLSDGQGMALEKPQDKPAERGN
FT                   EKAGSMGAGKEPERQLPG"
     MNKRPRHSRL MRYYLFRTRR LSRRQLGSWQ DWKLRAVFWS GAVMVGLLVV AFAWVAELAS        60
     HTFTQIHARS PYLPVLITPV GMVVIVWLMR QLGTESQGSG IPQVLVVLKQ RYHWLRPAFL       120
     SLRVILSKFV LTCLGLLCGA SIGREGPSVH MGAAMMYSVG RVGQLNQKYV DNSLIVAGGA       180
     AGVSAAFNAP LAGIVFAIEE LSGSFEQRTS GTLIMAIILS GVVVLMIMGH YSFFGHPDGA       240
     LDITRDWAAI GVTALVCGLL GGFFSRLLIK GSQFLSPYAK EHPYRVVVLC ALVVVFLGLI       300
     TGGATYGSGY EQASTLLSGE QPGNWTFALA KMSATLVSYF TGIPGGLFSP SLAAGAGVGN       360
     VVGGFFPGSS LVGVTLVAMA AFLAGVIQRP ITSFVIVMEL TGNRHDILLP LMAGALLSAA       420
     VAKIVWPRPL YDSLADRLSD GQGMALEKPQ DKPAERGNEK AGSMGAGKEP ERQLPG           476
//

If you have problems or comments...

PBIL Back to PBIL home page