(data stored in ACNUC7421 zone)

EMBL: AM286690.PE360

AM286690.PE360       Location/Qualifiers
FT   CDS             396552..397280
FT                   /transl_table=11
FT                   /locus_tag="ABO_0360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15808"
FT                   /db_xref="GOA:Q0VSP0"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSP0"
FT                   /protein_id="CAL15808.1"
FT                   /translation="MARKPKSRAGIDDVVLMPVSPSQQKKRRRVLVLVALFAGVLLFLI
FT                   GGWLGAGGVMDASDSNRRLRGEAKILQAELDTARSQLAVFRADSELTLEAREEVRQEIK
FT                   ALQDQVAELEEAVLFYKNVMAPGGSEGGLQIEKMTLQHNSDTGEYLYRVVLVQSGDNRG
FT                   YLSGDISLQLRGEKNGKAFIVAGSDWLEEGSETQFRFRYFQELNGRFKVPEGVAVQALD
FT                   VDAESGGMSRYETQKTIKWQ"
     MARKPKSRAG IDDVVLMPVS PSQQKKRRRV LVLVALFAGV LLFLIGGWLG AGGVMDASDS        60
     NRRLRGEAKI LQAELDTARS QLAVFRADSE LTLEAREEVR QEIKALQDQV AELEEAVLFY       120
     KNVMAPGGSE GGLQIEKMTL QHNSDTGEYL YRVVLVQSGD NRGYLSGDIS LQLRGEKNGK       180
     AFIVAGSDWL EEGSETQFRF RYFQELNGRF KVPEGVAVQA LDVDAESGGM SRYETQKTIK       240
     WQ                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page