(data stored in ACNUC7421 zone)

EMBL: AM286690.PE365

AM286690.PE365       Location/Qualifiers
FT   CDS             complement(400196..401515)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0365"
FT                   /product="peptidase, M23/M37 family"
FT                   /note="peptidase M23/M37 family identified by match to PFAM
FT                   protein family HMMPF04225"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15813"
FT                   /db_xref="GOA:Q0VSN5"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSN5"
FT                   /inference="protein motif:HMMPFAM:HMMPF04225"
FT                   /protein_id="CAL15813.1"
FT                   /translation="MKQLISAAGRLVRQFPRTHLLLSMVLLGGVILIAFRPDSTEPTPE
FT                   RIQNISLPERVTPTPQPTNKPATIATEWQTVTVKAGDSLSSLLQPLGIGAQQVYKLIGS
FT                   DTRLERLASLRPGDTLQVAISDEQTLTAVQYHPSRVETLTARLKNGRWQTRISQREYQK
FT                   QTRFAQAQITDSLFLAGAAAGISDKLTLQLANLFAWDVDFVLDIRKGDRFRILYEELYL
FT                   DGEKVGVGDILMAEFWNRDRHLTAFRYKTLSGDVEYLDIKGGSLRKEFIRTPVAFSRIS
FT                   SRFSLGRKHPILNRIRAHKGIDYAAPSGTPIKAAGDGKVIFAGIKGGYGNVLIIKHGQS
FT                   YTTLYAHMRNFAKDMRVGRRVKQGQTIGYVGMSGLATGPHLHYEFRINGVHRNPLTVPL
FT                   PKARGINDNERAEFLIAANQLKAQMTLFSEASTLASSDVF"
     MKQLISAAGR LVRQFPRTHL LLSMVLLGGV ILIAFRPDST EPTPERIQNI SLPERVTPTP        60
     QPTNKPATIA TEWQTVTVKA GDSLSSLLQP LGIGAQQVYK LIGSDTRLER LASLRPGDTL       120
     QVAISDEQTL TAVQYHPSRV ETLTARLKNG RWQTRISQRE YQKQTRFAQA QITDSLFLAG       180
     AAAGISDKLT LQLANLFAWD VDFVLDIRKG DRFRILYEEL YLDGEKVGVG DILMAEFWNR       240
     DRHLTAFRYK TLSGDVEYLD IKGGSLRKEF IRTPVAFSRI SSRFSLGRKH PILNRIRAHK       300
     GIDYAAPSGT PIKAAGDGKV IFAGIKGGYG NVLIIKHGQS YTTLYAHMRN FAKDMRVGRR       360
     VKQGQTIGYV GMSGLATGPH LHYEFRINGV HRNPLTVPLP KARGINDNER AEFLIAANQL       420
     KAQMTLFSEA STLASSDVF                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page