(data stored in ACNUC7421 zone)

EMBL: AM286690.PE369

AM286690.PE369       Location/Qualifiers
FT   CDS             411865..412602
FT                   /transl_table=11
FT                   /locus_tag="ABO_0369"
FT                   /product="transcriptional activator, putative"
FT                   /EC_number="6.3.4.15"
FT                   /note="transcriptional activator putative identified by
FT                   match to PFAM protein family HMMPF03309"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15817"
FT                   /db_xref="GOA:Q0VSN1"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSN1"
FT                   /inference="protein motif:HMMPFAM:HMMPF03309"
FT                   /protein_id="CAL15817.1"
FT                   /translation="MMLFVDVGNTAMKWRYRDGDVIHQGGGRHEREWSRVVELMLRSLV
FT                   GMPSEIWVASVAGPEADETIAYYLKEAIRCEPHFYYSCQSDFGVESCYPEPRKLGVDRW
FT                   VAMIEGFQRYGASIIIDCGSALTIDAVDSRGTFLGGYIVPGLGMLRGALLRDTSDVHIE
FT                   PGMAQLGLGRSTGECVHNGLLRMSVAFVTEVVLELRQVLDDTCKVLVTGGDAPELIGAF
FT                   TFEFLHAPDLVLDGLERVAARQQ"
     MMLFVDVGNT AMKWRYRDGD VIHQGGGRHE REWSRVVELM LRSLVGMPSE IWVASVAGPE        60
     ADETIAYYLK EAIRCEPHFY YSCQSDFGVE SCYPEPRKLG VDRWVAMIEG FQRYGASIII       120
     DCGSALTIDA VDSRGTFLGG YIVPGLGMLR GALLRDTSDV HIEPGMAQLG LGRSTGECVH       180
     NGLLRMSVAF VTEVVLELRQ VLDDTCKVLV TGGDAPELIG AFTFEFLHAP DLVLDGLERV       240
     AARQQ                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page