(data stored in ACNUC7421 zone)

EMBL: AM286690.PE39

AM286690.PE39        Location/Qualifiers
FT   CDS             complement(39944..40759)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0039"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15487"
FT                   /db_xref="InterPro:IPR021729"
FT                   /db_xref="InterPro:IPR025303"
FT                   /db_xref="InterPro:IPR037126"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTM1"
FT                   /protein_id="CAL15487.1"
FT                   /translation="MRITLILLIASALLAGCEDSNAPAKPTAKSTDSAAAIKNPAANPK
FT                   GATPQTLVRNVHALEKTDEQCDADGCPKVDLQWLTFENQAELNDAITQHLAAMLIHNED
FT                   NPNHDVRIEDLADAFLQDASDMAMASRQGWELTATVKKQGRRGDVITLSMETYEYTGGA
FT                   HGVPSVQYFHWDLAKQQSVKLNDMLVPGQQAAFWEKAREQHTAWLNKENLDQAFRDSWP
FT                   FDKTDNVFFTDKGLVLQYNVYHIAPYAMGQPTLTIPYSDLDGILRAPYL"
     MRITLILLIA SALLAGCEDS NAPAKPTAKS TDSAAAIKNP AANPKGATPQ TLVRNVHALE        60
     KTDEQCDADG CPKVDLQWLT FENQAELNDA ITQHLAAMLI HNEDNPNHDV RIEDLADAFL       120
     QDASDMAMAS RQGWELTATV KKQGRRGDVI TLSMETYEYT GGAHGVPSVQ YFHWDLAKQQ       180
     SVKLNDMLVP GQQAAFWEKA REQHTAWLNK ENLDQAFRDS WPFDKTDNVF FTDKGLVLQY       240
     NVYHIAPYAM GQPTLTIPYS DLDGILRAPY L                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page