(data stored in ACNUC7421 zone)

EMBL: AM286690.PE424

AM286690.PE424       Location/Qualifiers
FT   CDS             462272..462607
FT                   /transl_table=11
FT                   /locus_tag="ABO_0424"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15872"
FT                   /db_xref="InterPro:IPR014980"
FT                   /db_xref="InterPro:IPR023389"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSH6"
FT                   /protein_id="CAL15872.1"
FT                   /translation="MAINGFHAHVYFDEHTFSQAAALCQAAHQRFSIPMGHMHRKPVGP
FT                   HPCWSCQLTLPRRLVGEVIPWLMASRNGLTVFVHGLSGDDLRDHTELVMWLGDSLPLDL
FT                   STFGLSP"
     MAINGFHAHV YFDEHTFSQA AALCQAAHQR FSIPMGHMHR KPVGPHPCWS CQLTLPRRLV        60
     GEVIPWLMAS RNGLTVFVHG LSGDDLRDHT ELVMWLGDSL PLDLSTFGLS P                111
//

If you have problems or comments...

PBIL Back to PBIL home page