(data stored in ACNUC7421 zone)

EMBL: AM286690.PE428

AM286690.PE428       Location/Qualifiers
FT   CDS             complement(467603..468253)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0428"
FT                   /product="DNA-binding response regulator, LuxR family"
FT                   /function="Function unclear"
FT                   /note="DNA-binding response regulator LuxR family
FT                   identified by match to PFAM protein family HMMPF00072
FT                   InterPro: Bacterial regulatory protein LuxR family"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15876"
FT                   /db_xref="GOA:Q0VSH2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSH2"
FT                   /inference="protein motif:HMMPFAM:HMMPF00072"
FT                   /protein_id="CAL15876.1"
FT                   /translation="MNSQEHIQQVYVVGSQQLQNALLTEFLVKKDMAAKSIPTALDITI
FT                   DALRENGQNLFLVDYHSVDVNEVIAHLLEADQEVESDVLIAVFNVDSDESLSKLAGLPM
FT                   VNGGFQHDCPQALLSKGLKAILDGELWFPRAVLQTYLMKSRTFNKTFSRSEVSLTDREV
FT                   EVLKVMATGAKNSDIACSLNLSPHTIKTHIYNIFKKINASNRLQAVNWAQENL"
     MNSQEHIQQV YVVGSQQLQN ALLTEFLVKK DMAAKSIPTA LDITIDALRE NGQNLFLVDY        60
     HSVDVNEVIA HLLEADQEVE SDVLIAVFNV DSDESLSKLA GLPMVNGGFQ HDCPQALLSK       120
     GLKAILDGEL WFPRAVLQTY LMKSRTFNKT FSRSEVSLTD REVEVLKVMA TGAKNSDIAC       180
     SLNLSPHTIK THIYNIFKKI NASNRLQAVN WAQENL                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page