(data stored in ACNUC7421 zone)

EMBL: AM286690.PE431

AM286690.PE431       Location/Qualifiers
FT   CDS             470522..471250
FT                   /transl_table=11
FT                   /locus_tag="ABO_0431"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15879"
FT                   /db_xref="InterPro:IPR022792"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSG9"
FT                   /protein_id="CAL15879.1"
FT                   /translation="MPRKITLALLFGVSLLLFLLLLMPAAVLVERVPALRPGGAPLVLT
FT                   NPQGVWWNGQANWQWQRRQGTVQWSLDWHGLVPGLTLKMRTTDDAARLSTWLGADWGDW
FT                   QLQHARLSLPMALVTEHIPQGSASGRVDATLMQLSFGDSRVKQLQGTLQYSGGTVSWGR
FT                   NGSALVPVLQGRLSMNNEQPTLQVEDPDNNSLLDARLANGRFELEVRRAWPMLLGVSQG
FT                   GDPDDVVFQMSQPLVLFGGQ"
     MPRKITLALL FGVSLLLFLL LLMPAAVLVE RVPALRPGGA PLVLTNPQGV WWNGQANWQW        60
     QRRQGTVQWS LDWHGLVPGL TLKMRTTDDA ARLSTWLGAD WGDWQLQHAR LSLPMALVTE       120
     HIPQGSASGR VDATLMQLSF GDSRVKQLQG TLQYSGGTVS WGRNGSALVP VLQGRLSMNN       180
     EQPTLQVEDP DNNSLLDARL ANGRFELEVR RAWPMLLGVS QGGDPDDVVF QMSQPLVLFG       240
     GQ                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page