(data stored in ACNUC7421 zone)

EMBL: AM286690.PE432

AM286690.PE432       Location/Qualifiers
FT   CDS             471336..472196
FT                   /transl_table=11
FT                   /locus_tag="ABO_0432"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15880"
FT                   /db_xref="GOA:Q0VSG8"
FT                   /db_xref="InterPro:IPR024961"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSG8"
FT                   /protein_id="CAL15880.1"
FT                   /translation="MSQLASWVKQQQWGAPLRWVIAVLLVVAMAYVLAQTVWLLWYGPS
FT                   ERVQSNSKTRLDVSSSGDAPILSQSQVDGWQLFGQYEAAASIDKDRPTDAPDTRLRLEL
FT                   LGVFQNADTKRATAIIAEKGKEGELYHIGDSIPGNAKLEEVYPDRVILRRAGRLETLRW
FT                   SDSVLGGVAQVKQKPTPPPSRNRTVAQGSPADLARQRKTIIGQLGLDPIDKSGSAGYRL
FT                   GKGAPKQLLAQVGLRSDDVILSVNGHPLGTESNDVAALRSYQDTQKASIVVQRGDQQFT
FT                   VNYPP"
     MSQLASWVKQ QQWGAPLRWV IAVLLVVAMA YVLAQTVWLL WYGPSERVQS NSKTRLDVSS        60
     SGDAPILSQS QVDGWQLFGQ YEAAASIDKD RPTDAPDTRL RLELLGVFQN ADTKRATAII       120
     AEKGKEGELY HIGDSIPGNA KLEEVYPDRV ILRRAGRLET LRWSDSVLGG VAQVKQKPTP       180
     PPSRNRTVAQ GSPADLARQR KTIIGQLGLD PIDKSGSAGY RLGKGAPKQL LAQVGLRSDD       240
     VILSVNGHPL GTESNDVAAL RSYQDTQKAS IVVQRGDQQF TVNYPP                      286
//

If you have problems or comments...

PBIL Back to PBIL home page