(data stored in ACNUC7421 zone)

EMBL: AM286690.PE437

AM286690.PE437       Location/Qualifiers
FT   CDS             478145..478636
FT                   /transl_table=11
FT                   /locus_tag="ABO_0437"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15885"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023292"
FT                   /db_xref="InterPro:IPR033653"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSG3"
FT                   /protein_id="CAL15885.1"
FT                   /translation="MAIKSNNSNFHRVAEFHRAFSLPVEPQPVVPDDATVRLRLALLLE
FT                   EFYELVEATCQEVSEGQRKFLMTLAQAREQLEELEGFQVDLVEVADALTDINYVTYGAG
FT                   HTFGIDLNACCKEVHRSNMSKLGADGQPVKDERGKVLKGPAYSPPSLAQVLANQAGGAE
FT                   "
     MAIKSNNSNF HRVAEFHRAF SLPVEPQPVV PDDATVRLRL ALLLEEFYEL VEATCQEVSE        60
     GQRKFLMTLA QAREQLEELE GFQVDLVEVA DALTDINYVT YGAGHTFGID LNACCKEVHR       120
     SNMSKLGADG QPVKDERGKV LKGPAYSPPS LAQVLANQAG GAE                         163
//

If you have problems or comments...

PBIL Back to PBIL home page