(data stored in ACNUC7421 zone)

EMBL: AM286690.PE44

AM286690.PE44        Location/Qualifiers
FT   CDS             complement(44641..45114)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0044"
FT                   /product="AhpC/TSA family protein"
FT                   /function="directly reducing organic hyperoxides in its
FT                   reduced dithiol form"
FT                   /EC_number="1.11.1.-"
FT                   /note="AhpC/TSA family protein identified by
FT                   sequencesimilarity; putative"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15492"
FT                   /db_xref="GOA:Q0VTL6"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTL6"
FT                   /protein_id="CAL15492.1"
FT                   /translation="MSIAVGDNLPSITLKTNGPDGPQDLNTGDFFKGRKVVLFAVPGAF
FT                   TPGCSNTHMPGFVINADALLEKVDAIACMAVNDAFVMGAWQKDQNAERITMLADGNAEL
FT                   AKALGLELDATGGCMGIRSKRFALIANDGVVEYLGVDAKGVDKSSADTVLKQL"
     MSIAVGDNLP SITLKTNGPD GPQDLNTGDF FKGRKVVLFA VPGAFTPGCS NTHMPGFVIN        60
     ADALLEKVDA IACMAVNDAF VMGAWQKDQN AERITMLADG NAELAKALGL ELDATGGCMG       120
     IRSKRFALIA NDGVVEYLGV DAKGVDKSSA DTVLKQL                                157
//

If you have problems or comments...

PBIL Back to PBIL home page