(data stored in ACNUC7421 zone)

EMBL: AM286690.PE445

AM286690.PE445       Location/Qualifiers
FT   CDS             complement(487392..487820)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0445"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15893"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSF5"
FT                   /protein_id="CAL15893.1"
FT                   /translation="MGELKDLREQSESLVNRAKQLGNKLYLAGLGAYEKAEEGSEELFN
FT                   KYVETGSKAFGEEAESKPKALLASRGALVAARELLDSAPEKRLALYQKLLEAGKKERGE
FT                   KAEETNEYLLASLGAVATAREEGEKLFNELVSTGEKRD"
     MGELKDLREQ SESLVNRAKQ LGNKLYLAGL GAYEKAEEGS EELFNKYVET GSKAFGEEAE        60
     SKPKALLASR GALVAARELL DSAPEKRLAL YQKLLEAGKK ERGEKAEETN EYLLASLGAV       120
     ATAREEGEKL FNELVSTGEK RD                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page