(data stored in ACNUC7421 zone)

EMBL: AM286690.PE450

AM286690.PE450       Location/Qualifiers
FT   CDS             complement(490620..491207)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15898"
FT                   /db_xref="InterPro:IPR005619"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSF0"
FT                   /protein_id="CAL15898.1"
FT                   /translation="MTMLRAALIFTATTLFAGCALSPQMITVAPKADVEAANIGHNEPV
FT                   QVIAVDSREQSAFGTRGGVYKETALVQPANDVKNAIEDAVRKGLQNQGFNAFNAGADAT
FT                   RLEVRLEQLDYVPEEGSVVNEVTLSLTLLAEASRADVVHIGTYKSSVVHDLPLTPTANR
FT                   NQTMINEILSSAITRMLTDPKMQAFLAGNDTP"
     MTMLRAALIF TATTLFAGCA LSPQMITVAP KADVEAANIG HNEPVQVIAV DSREQSAFGT        60
     RGGVYKETAL VQPANDVKNA IEDAVRKGLQ NQGFNAFNAG ADATRLEVRL EQLDYVPEEG       120
     SVVNEVTLSL TLLAEASRAD VVHIGTYKSS VVHDLPLTPT ANRNQTMINE ILSSAITRML       180
     TDPKMQAFLA GNDTP                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page