(data stored in ACNUC7421 zone)

EMBL: AM286690.PE451

AM286690.PE451       Location/Qualifiers
FT   CDS             complement(491228..492151)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0451"
FT                   /product="transferases"
FT                   /EC_number="2.5.1.-"
FT                   /note="transferases identified by sequence similarity;
FT                   putative InterPro: Polyprenyl synthetase"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15899"
FT                   /db_xref="GOA:Q0VSE9"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSE9"
FT                   /protein_id="CAL15899.1"
FT                   /translation="MNQFISHHLDSNVPLIREVGDYIIQSGGKRLRPLIAVLCARASGY
FT                   QGSRHVDVAAIIEFLHTATLLHDDVVDESNLRRGRPTVNAVWGNAASVLVGDFLISRAL
FT                   QLMVALRHPRLLDIFSQSTNTISEGEVLQLINVRDPNTSEDNYMRVIHHKTAKMFESAA
FT                   ETGAVLGANDVSDHVDAFATYGRHLGIAFQLIDDVLDYQGDASELGKNVGDDLAEGKPT
FT                   LPLIHTIANGSAEQATLIKDAIRSGGLEHLEQIVETVRASGGLQYTVDKAAEQTRIALD
FT                   AIAQVPASPYKDALFRLAEESLKRTY"
     MNQFISHHLD SNVPLIREVG DYIIQSGGKR LRPLIAVLCA RASGYQGSRH VDVAAIIEFL        60
     HTATLLHDDV VDESNLRRGR PTVNAVWGNA ASVLVGDFLI SRALQLMVAL RHPRLLDIFS       120
     QSTNTISEGE VLQLINVRDP NTSEDNYMRV IHHKTAKMFE SAAETGAVLG ANDVSDHVDA       180
     FATYGRHLGI AFQLIDDVLD YQGDASELGK NVGDDLAEGK PTLPLIHTIA NGSAEQATLI       240
     KDAIRSGGLE HLEQIVETVR ASGGLQYTVD KAAEQTRIAL DAIAQVPASP YKDALFRLAE       300
     ESLKRTY                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page