(data stored in ACNUC7421 zone)

EMBL: AM286690.PE454

AM286690.PE454       Location/Qualifiers
FT   CDS             493209..494384
FT                   /transl_table=11
FT                   /locus_tag="ABO_0454"
FT                   /product="GTP-binding protein, GTP1/Obg family"
FT                   /note="GTP-binding protein GTP1/Obg family identified by
FT                   match to TIGR protein family HMMTIGR00231 InterPro:
FT                   GTP1/OBG family"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15902"
FT                   /db_xref="GOA:Q0VSE6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSE6"
FT                   /inference="protein motif:HMMTIGR:HMMTIGR00231"
FT                   /protein_id="CAL15902.1"
FT                   /translation="MQFVDEATIDVHAGKGGDGCLSFRREKYVEFGGPDGGDGGAGGHV
FT                   FVQADTNINTLVDYRYDRIFKARNGEPGKGRQMTGKSAEDIILYVPVGTTVVDLDTDEV
FT                   LADLTDTDKPVMVAQAGRGGLGNIHFKSSVNQAPRKTTKGKPGESRRLRLELKVLADVG
FT                   LLGMPNAGKSTLIRAISAAKPKVADYPFTTLIPNLGVVKADRYRSFVVADIPGLIEGAA
FT                   EGAGLGIRFLKHLARTRLLLHVVDLAPMDGSSPANHIDAIADELDRFSPALAEQERWLV
FT                   FNKIDLLADDEAQAQVDAIVDELGWQGPVFKVSAAAGVGCEDLVYALMNAIEDRRLLER
FT                   EDPAYAAAQQDLRARLEEEARERVQELKAEARQARQNDDDDDHDVEVVYEP"
     MQFVDEATID VHAGKGGDGC LSFRREKYVE FGGPDGGDGG AGGHVFVQAD TNINTLVDYR        60
     YDRIFKARNG EPGKGRQMTG KSAEDIILYV PVGTTVVDLD TDEVLADLTD TDKPVMVAQA       120
     GRGGLGNIHF KSSVNQAPRK TTKGKPGESR RLRLELKVLA DVGLLGMPNA GKSTLIRAIS       180
     AAKPKVADYP FTTLIPNLGV VKADRYRSFV VADIPGLIEG AAEGAGLGIR FLKHLARTRL       240
     LLHVVDLAPM DGSSPANHID AIADELDRFS PALAEQERWL VFNKIDLLAD DEAQAQVDAI       300
     VDELGWQGPV FKVSAAAGVG CEDLVYALMN AIEDRRLLER EDPAYAAAQQ DLRARLEEEA       360
     RERVQELKAE ARQARQNDDD DDHDVEVVYE P                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page