(data stored in ACNUC7421 zone)

EMBL: AM286690.PE457

AM286690.PE457       Location/Qualifiers
FT   CDS             496206..497771
FT                   /transl_table=11
FT                   /locus_tag="ABO_0457"
FT                   /product="membrane protein, MviN family"
FT                   /note="identified by match to PFAM protein family
FT                   HMMPF03023 InterPro: Virulence factor MVIN-like"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15905"
FT                   /db_xref="GOA:Q0VSE3"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSE3"
FT                   /inference="protein motif:HMMPFAM:HMMPF03023"
FT                   /protein_id="CAL15905.1"
FT                   /translation="MTDIPEQPPKKAGLLASTAVVATMTMLSRVLGLVRDVVIARMLGA
FT                   SAGADAFFVALKIPNFLRRLFAEGAFNQAFVPVLSEYRSKGSMAATKLLVDRVAGTLGG
FT                   TLMLVTLVGVLAAPGIIWIFAPGFGDDPAKRALTVEMLRLTFPYLFFIALTAFAGGILN
FT                   SWNRFAVPAFTPVLLNLSLIGCALFLAPHFAEERMAVALAWGVLIAGIAQLLFQLPFLA
FT                   RLNLMPIPRMGWSDPGVRKIMRLMAPALFGASVYQLNSLVNTILASMLETGSVTWLYYT
FT                   DRLIELPLGIFAVAIGTVILPSLSSKHADASAEAFSRTLDWAIRMVLLVGLPAALALFA
FT                   LAEPLLSTLFQYGEFSAFDVTKTAASLRAYSAGLLAAMLIKVLAPGFYARQDTRTPVRI
FT                   GVLAMLANMLLGALLVWEWRHVGLASAMALSAWLNAGLLYLGLRRSGVYQPLSGWGLQW
FT                   LRMLLAGASMVAACYWLSLQTTAWNEPGVWPRVGWLSLIVAAGVAIYLSSLVVLGLRVR
FT                   HLRR"
     MTDIPEQPPK KAGLLASTAV VATMTMLSRV LGLVRDVVIA RMLGASAGAD AFFVALKIPN        60
     FLRRLFAEGA FNQAFVPVLS EYRSKGSMAA TKLLVDRVAG TLGGTLMLVT LVGVLAAPGI       120
     IWIFAPGFGD DPAKRALTVE MLRLTFPYLF FIALTAFAGG ILNSWNRFAV PAFTPVLLNL       180
     SLIGCALFLA PHFAEERMAV ALAWGVLIAG IAQLLFQLPF LARLNLMPIP RMGWSDPGVR       240
     KIMRLMAPAL FGASVYQLNS LVNTILASML ETGSVTWLYY TDRLIELPLG IFAVAIGTVI       300
     LPSLSSKHAD ASAEAFSRTL DWAIRMVLLV GLPAALALFA LAEPLLSTLF QYGEFSAFDV       360
     TKTAASLRAY SAGLLAAMLI KVLAPGFYAR QDTRTPVRIG VLAMLANMLL GALLVWEWRH       420
     VGLASAMALS AWLNAGLLYL GLRRSGVYQP LSGWGLQWLR MLLAGASMVA ACYWLSLQTT       480
     AWNEPGVWPR VGWLSLIVAA GVAIYLSSLV VLGLRVRHLR R                           521
//

If you have problems or comments...

PBIL Back to PBIL home page