(data stored in ACNUC7421 zone)

EMBL: AM286690.PE46

AM286690.PE46        Location/Qualifiers
FT   CDS             complement(47966..50062)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0046"
FT                   /product="protein containing a von Willebrand factor type A
FT                   domain"
FT                   /note="uncharacterized protein containing a von Willebrand
FT                   factor type (vWA) domain identified by match to PFAM
FT                   protein family HMMPF00092 InterPro: von Willebrand factor
FT                   type A domain"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15494"
FT                   /db_xref="GOA:Q0VTG8"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR013694"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTG8"
FT                   /inference="protein motif:HMMPFAM:HMMPF00092"
FT                   /protein_id="CAL15494.1"
FT                   /translation="MGFRNGYTRFAAGLALLFGCLLTNPTLAAGLMTPANSSLPPLQIR
FT                   EQHVTVDVEDGYAITEVEQVFHNPNNQDLEAYYRFPVPEKGTVAEFTAWIDGKPVIGEV
FT                   LEKQQARQVYEQEKAAGREAGLTEKDSFKAFDVKVQPVRAGQDTRVRLVYMQPAFVDNG
FT                   IGRYVYPLEEGSVDEKKLAFWTANEKVEERFSFTLNLRSSYPVDALRLPKHPQAKIQQL
FT                   GSQQWQVTLDNRNASTTIKGKGRSEKGDNNFAPPATNGHPPSAFTLDQDIVVYWRHQQD
FT                   LPGSVDLVAYKAPGKDRGTFMLSITPGDDLPPITTGSDWVFVLDISGSMNAKLATLGDG
FT                   VRQALGKLRGNDRFRIVLFDDRAEELTSGFVDATPNNIRQYTQKIMQLQSRGGTNLFGG
FT                   LSLALTPLDADRPTGIVLVTDGVANVGKTRQKDFIDLLENHDVRLFTFVMGNSANRPML
FT                   TAMTDASNGFAISVSNSDDIAGQILNATSKVTHQAMNDVEIDIDGIRTADLQPQRIGSI
FT                   YHGRQIVLLGHYWGDGPAKITLRAEVAGQEKTYKTRFDFPAQGGNNPELERLWAYATVQ
FT                   DMQQEIEYFGEEKDLQQGITDLGIEYGLVTHYTSMVVLREEVFKEYGIDRRNTKRREIE
FT                   KRAKAQRQASAPSGNRVDNSQPMYNSNRPSYSSGSGGSGGAFGMGALLPFLILLIGGRL
FT                   RRRH"
     MGFRNGYTRF AAGLALLFGC LLTNPTLAAG LMTPANSSLP PLQIREQHVT VDVEDGYAIT        60
     EVEQVFHNPN NQDLEAYYRF PVPEKGTVAE FTAWIDGKPV IGEVLEKQQA RQVYEQEKAA       120
     GREAGLTEKD SFKAFDVKVQ PVRAGQDTRV RLVYMQPAFV DNGIGRYVYP LEEGSVDEKK       180
     LAFWTANEKV EERFSFTLNL RSSYPVDALR LPKHPQAKIQ QLGSQQWQVT LDNRNASTTI       240
     KGKGRSEKGD NNFAPPATNG HPPSAFTLDQ DIVVYWRHQQ DLPGSVDLVA YKAPGKDRGT       300
     FMLSITPGDD LPPITTGSDW VFVLDISGSM NAKLATLGDG VRQALGKLRG NDRFRIVLFD       360
     DRAEELTSGF VDATPNNIRQ YTQKIMQLQS RGGTNLFGGL SLALTPLDAD RPTGIVLVTD       420
     GVANVGKTRQ KDFIDLLENH DVRLFTFVMG NSANRPMLTA MTDASNGFAI SVSNSDDIAG       480
     QILNATSKVT HQAMNDVEID IDGIRTADLQ PQRIGSIYHG RQIVLLGHYW GDGPAKITLR       540
     AEVAGQEKTY KTRFDFPAQG GNNPELERLW AYATVQDMQQ EIEYFGEEKD LQQGITDLGI       600
     EYGLVTHYTS MVVLREEVFK EYGIDRRNTK RREIEKRAKA QRQASAPSGN RVDNSQPMYN       660
     SNRPSYSSGS GGSGGAFGMG ALLPFLILLI GGRLRRRH                               698
//

If you have problems or comments...

PBIL Back to PBIL home page