(data stored in ACNUC7421 zone)

EMBL: AM286690.PE464

AM286690.PE464       Location/Qualifiers
FT   CDS             504463..504981
FT                   /transl_table=11
FT                   /locus_tag="ABO_0464"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15912"
FT                   /db_xref="GOA:Q0VSD6"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013362"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSD6"
FT                   /protein_id="CAL15912.1"
FT                   /translation="MMITGKQQRGVGLIEVMIALLVLAIGVLGYAGMQLTALKASEDAN
FT                   NRAQATLLGQDALERFLANETAMASYTDVDQWPDESTPPGEKPDVLNDCITSSCNANDL
FT                   ASWDISMLAWQAANQLPAGMIAVDECQHATGISCVVVSWNDDEPNDCMTNDGVNTGIGT
FT                   SCVVLEVAR"
     MMITGKQQRG VGLIEVMIAL LVLAIGVLGY AGMQLTALKA SEDANNRAQA TLLGQDALER        60
     FLANETAMAS YTDVDQWPDE STPPGEKPDV LNDCITSSCN ANDLASWDIS MLAWQAANQL       120
     PAGMIAVDEC QHATGISCVV VSWNDDEPND CMTNDGVNTG IGTSCVVLEV AR               172
//

If you have problems or comments...

PBIL Back to PBIL home page