(data stored in ACNUC7421 zone)

EMBL: AM286690.PE466

AM286690.PE466       Location/Qualifiers
FT   CDS             505691..506242
FT                   /transl_table=11
FT                   /locus_tag="ABO_0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15914"
FT                   /db_xref="InterPro:IPR025746"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSD4"
FT                   /protein_id="CAL15914.1"
FT                   /translation="MGCRMTTNMIIWKRQQGAALVVALLILVVVSLLGVSAMKSSVFSA
FT                   KVATGTQADAMTFEAAETTLAEAYKELNNMSGADLYTKLAGGELLIRCVTEEDTTKEGA
FT                   CSQGDALDSRGLIVAQSFSKLNGYDPVPGSQISTTGGGAIFVDYKIAMLGESEMSSFNL
FT                   DNHHLQEALKRGIKPGSEIE"
     MGCRMTTNMI IWKRQQGAAL VVALLILVVV SLLGVSAMKS SVFSAKVATG TQADAMTFEA        60
     AETTLAEAYK ELNNMSGADL YTKLAGGELL IRCVTEEDTT KEGACSQGDA LDSRGLIVAQ       120
     SFSKLNGYDP VPGSQISTTG GGAIFVDYKI AMLGESEMSS FNLDNHHLQE ALKRGIKPGS       180
     EIE                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page