(data stored in ACNUC7421 zone)

EMBL: AM286690.PE467

AM286690.PE467       Location/Qualifiers
FT   CDS             506252..509281
FT                   /transl_table=11
FT                   /locus_tag="ABO_0467"
FT                   /product="pilin biogenesis related protein"
FT                   /function="Tfp pilus assembly protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15915"
FT                   /db_xref="InterPro:IPR008707"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSD3"
FT                   /protein_id="CAL15915.1"
FT                   /translation="MSYSKKVYLLVLMVFMAPVAIHADDTEIYYSQAAAGGSENKPSAN
FT                   VMVLLDTSGSMRFCKNSEANVAWCSDVEERRINMLEDAMHVLIDSVPGDVKMGLGRFNA
FT                   GYNCNSGRNTCGAHVLLPVTDIDEKTKRVFKDTVSSLNSAGGSPSGPSDGAPYGSTPTA
FT                   EAYWEMGRYMIGSSPQSYTSYGDSSNDDNTSEVCLEYEENQTCSNVNVYGWMDLPANDS
FT                   CNTSSSTCRRECVSRWLVFCQEYVYQRYQIVGQEQECETTEICVDEKKIVDNGNYVSPR
FT                   NTANECESNHIVLFTDGEANDVNLPCGGGSSYDCQRAISDYLDRDFEIKTYNVGLHMED
FT                   NRADMETVSSDGADGTYTASDAESLASAFLDIFDLIEKESRSIAAPGVAINQMDRFQHL
FT                   DQLYYSVFEPSENSYWQGNLKRYQLEDGVIKGKNGPAVDQDTGFFKEFSQSFWSDEVDG
FT                   YDAKIGGAREEVSSRRLFYTTAGGDTRKIDWENIANNNLTKESFGLNSGADDDELENLL
FT                   DEMKVMWGDPLHSVPVMVNYGGDSDNNIVFVSNNGGMLHAVDAKNGEEKFAFMPYEFFS
FT                   RANEYTTERLALKDRNIRQSYGLDGSWVAWRRPGDTVDAKPSDVFLYGGMRRGGRDYYA
FT                   VDVGNISSPSMMWQIKGGSGDFSNLGQTWSTPTLTQIPVGGENVPVLVFGGGYDSAAHD
FT                   KKQGKSRGNGDSMGNAIYIVDARTGELIWSASDTGASTNVASMKWSIPSSIAVVDKEFD
FT                   GIADYLYFGDLGGQVFRVDIDQTGGKKMKVHRLARVSGSSVSDNRRIYEAPSVVYLNDN
FT                   GVNTLYVAVATGYRSHPLDENISDGIFVIKDKTALSTSMDAPDDVMLSQLTDVATGTPE
FT                   ESDMGWYYLLEKGEKSLASPVVFKNILRFTTYKPEKAVGDDDSACSVSFGKSFLHTVNI
FT                   ETAEPASFNNDGNVPTSRSEELEQTTPPPSPVLVTDGEGNVYVVVGTEVIGAEDLGYTH
FT                   LRKRRWYQMDKTKANEFKAP"
     MSYSKKVYLL VLMVFMAPVA IHADDTEIYY SQAAAGGSEN KPSANVMVLL DTSGSMRFCK        60
     NSEANVAWCS DVEERRINML EDAMHVLIDS VPGDVKMGLG RFNAGYNCNS GRNTCGAHVL       120
     LPVTDIDEKT KRVFKDTVSS LNSAGGSPSG PSDGAPYGST PTAEAYWEMG RYMIGSSPQS       180
     YTSYGDSSND DNTSEVCLEY EENQTCSNVN VYGWMDLPAN DSCNTSSSTC RRECVSRWLV       240
     FCQEYVYQRY QIVGQEQECE TTEICVDEKK IVDNGNYVSP RNTANECESN HIVLFTDGEA       300
     NDVNLPCGGG SSYDCQRAIS DYLDRDFEIK TYNVGLHMED NRADMETVSS DGADGTYTAS       360
     DAESLASAFL DIFDLIEKES RSIAAPGVAI NQMDRFQHLD QLYYSVFEPS ENSYWQGNLK       420
     RYQLEDGVIK GKNGPAVDQD TGFFKEFSQS FWSDEVDGYD AKIGGAREEV SSRRLFYTTA       480
     GGDTRKIDWE NIANNNLTKE SFGLNSGADD DELENLLDEM KVMWGDPLHS VPVMVNYGGD       540
     SDNNIVFVSN NGGMLHAVDA KNGEEKFAFM PYEFFSRANE YTTERLALKD RNIRQSYGLD       600
     GSWVAWRRPG DTVDAKPSDV FLYGGMRRGG RDYYAVDVGN ISSPSMMWQI KGGSGDFSNL       660
     GQTWSTPTLT QIPVGGENVP VLVFGGGYDS AAHDKKQGKS RGNGDSMGNA IYIVDARTGE       720
     LIWSASDTGA STNVASMKWS IPSSIAVVDK EFDGIADYLY FGDLGGQVFR VDIDQTGGKK       780
     MKVHRLARVS GSSVSDNRRI YEAPSVVYLN DNGVNTLYVA VATGYRSHPL DENISDGIFV       840
     IKDKTALSTS MDAPDDVMLS QLTDVATGTP EESDMGWYYL LEKGEKSLAS PVVFKNILRF       900
     TTYKPEKAVG DDDSACSVSF GKSFLHTVNI ETAEPASFNN DGNVPTSRSE ELEQTTPPPS       960
     PVLVTDGEGN VYVVVGTEVI GAEDLGYTHL RKRRWYQMDK TKANEFKAP                  1009
//

If you have problems or comments...

PBIL Back to PBIL home page