(data stored in ACNUC7421 zone)

EMBL: AM286690.PE468

AM286690.PE468       Location/Qualifiers
FT   CDS             509301..509750
FT                   /transl_table=11
FT                   /locus_tag="ABO_0468"
FT                   /product="secretion protein, putative"
FT                   /function="Tfp pilus assembly protein PilE"
FT                   /note="secretion protein putative identifiedby sequence
FT                   similarity; putative InterPro: Fimbrial protein pilin"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15916"
FT                   /db_xref="GOA:Q0VSD2"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR031982"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSD2"
FT                   /protein_id="CAL15916.1"
FT                   /translation="MMSGKSVCKGRDQQGFTLIELMIVVVIVAILASIAYPSYTRYVQD
FT                   TRQAEAQGEMMALAGALERYRAKNFSYKGANTKLAVLSPVLANSDYFTTAISVTGTGSQ
FT                   QYEITVTPKTGVMTGTEVLKINSEGQTCMKVSGCTIGTDDSWKEH"
     MMSGKSVCKG RDQQGFTLIE LMIVVVIVAI LASIAYPSYT RYVQDTRQAE AQGEMMALAG        60
     ALERYRAKNF SYKGANTKLA VLSPVLANSD YFTTAISVTG TGSQQYEITV TPKTGVMTGT       120
     EVLKINSEGQ TCMKVSGCTI GTDDSWKEH                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page