(data stored in ACNUC7421 zone)

EMBL: AM286690.PE469

AM286690.PE469       Location/Qualifiers
FT   CDS             complement(509747..510277)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15917"
FT                   /db_xref="GOA:Q0VSD1"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSD1"
FT                   /protein_id="CAL15917.1"
FT                   /translation="MGALKMARHYQRPQQYGLTLIEILTSITIIGVLSVCASYAWNDII
FT                   PRYQVRTATMTLHSLIRQARAGAITDGNRMICDGQNGCNKFEETQQVWMGFDRNNDGNL
FT                   NASEIIEHYQLPGQTRLIWKRFKGNALVFHNKGNSHFQNGSFYLCNPVAARRITMNWIG
FT                   RPRVETAKPEDCD"
     MGALKMARHY QRPQQYGLTL IEILTSITII GVLSVCASYA WNDIIPRYQV RTATMTLHSL        60
     IRQARAGAIT DGNRMICDGQ NGCNKFEETQ QVWMGFDRNN DGNLNASEII EHYQLPGQTR       120
     LIWKRFKGNA LVFHNKGNSH FQNGSFYLCN PVAARRITMN WIGRPRVETA KPEDCD           176
//

If you have problems or comments...

PBIL Back to PBIL home page