(data stored in ACNUC7421 zone)

EMBL: AM286690.PE473

AM286690.PE473       Location/Qualifiers
FT   CDS             complement(514369..514611)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0473"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15921"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSC7"
FT                   /protein_id="CAL15921.1"
FT                   /translation="MGLIRLIIIAALIYLAWRVMKQLLAQARPTAPDNSTSNPQIMVKC
FT                   AQCGVHVPAPDAFSHGGLHFCSQEHQRQYLEQHDR"
     MGLIRLIIIA ALIYLAWRVM KQLLAQARPT APDNSTSNPQ IMVKCAQCGV HVPAPDAFSH        60
     GGLHFCSQEH QRQYLEQHDR                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page