(data stored in ACNUC7421 zone)

EMBL: AM286690.PE484

AM286690.PE484       Location/Qualifiers
FT   CDS             complement(527392..528279)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0484"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="transcriptional regulator LysR family identified by
FT                   match to PFAM protein family HMMPF03466 InterPro: Bacterial
FT                   regulatory protein LysR family"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15932"
FT                   /db_xref="GOA:Q0VSB6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037404"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSB6"
FT                   /inference="protein motif:HMMPFAM:HMMPF03466"
FT                   /protein_id="CAL15932.1"
FT                   /translation="MDTKPLRLFLTLADTLHFGRTSSMCHVSPSTLSRTIQQLEEELNV
FT                   PLFYRDNRSVTLTREGQRFQEYARDTLMRWDGLRHALQEDRRILQGELRLYCSVTASYS
FT                   FLYDLLSSFRHQYPRIELKLHTGDPAQAVQRIQQGEEDIAIGARPDHLPSGIAFRPIAR
FT                   SPLLFIAQAGQTQLAERLNGVAKQADWKDTPMILSEEGLARERVDRWFRQLGAKPHIYA
FT                   QVSGNEAIVSMVSLGFGVGVVPKIVLDNSPLAGRTRSLDVQPALAPYEVGLFTQERRQE
FT                   EPLINAFWSQLGDT"
     MDTKPLRLFL TLADTLHFGR TSSMCHVSPS TLSRTIQQLE EELNVPLFYR DNRSVTLTRE        60
     GQRFQEYARD TLMRWDGLRH ALQEDRRILQ GELRLYCSVT ASYSFLYDLL SSFRHQYPRI       120
     ELKLHTGDPA QAVQRIQQGE EDIAIGARPD HLPSGIAFRP IARSPLLFIA QAGQTQLAER       180
     LNGVAKQADW KDTPMILSEE GLARERVDRW FRQLGAKPHI YAQVSGNEAI VSMVSLGFGV       240
     GVVPKIVLDN SPLAGRTRSL DVQPALAPYE VGLFTQERRQ EEPLINAFWS QLGDT            295
//

If you have problems or comments...

PBIL Back to PBIL home page