(data stored in ACNUC7421 zone)

EMBL: AM286690.PE489

AM286690.PE489       Location/Qualifiers
FT   CDS             537982..538188
FT                   /transl_table=11
FT                   /locus_tag="ABO_0489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15937"
FT                   /db_xref="GOA:Q0VSB1"
FT                   /db_xref="InterPro:IPR018638"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSB1"
FT                   /protein_id="CAL15937.1"
FT                   /translation="MTKTISFGVMHISVAFLVVWAMTGDWRIGGLTALVEPCVNTVAYH
FT                   FHEKIWKTNKKADPAPVSGAIMV"
     MTKTISFGVM HISVAFLVVW AMTGDWRIGG LTALVEPCVN TVAYHFHEKI WKTNKKADPA        60
     PVSGAIMV                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page