(data stored in ACNUC7421 zone)

EMBL: AM286690.PE491

AM286690.PE491       Location/Qualifiers
FT   CDS             complement(538964..539776)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0491"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15939"
FT                   /db_xref="InterPro:IPR016980"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSA9"
FT                   /protein_id="CAL15939.1"
FT                   /translation="MRITFVLAAVLAFSPLCVAYTQADSLDDTLDAPHRTSAEKARDSY
FT                   RHPAKTLRFFNVEADMAVVEIWPGSKGWYTAILAPYLRDNGTYYAAQFPPDSNIPFYQR
FT                   SLIQFKTRLAKQDEIYNKVRITHLYPPVYNDIAPAGTVDRVLTFRNVHNWAKSGKGEAA
FT                   FKSFYKALKPGGVLGVVEHRAPEVRPLERQIETGYMSEGYVIALAEKAGFTLVDRSEIN
FT                   ANPKDQINHPAGVWTLPPTLRLGDKDRETYEAIGESDRMTLKFLKPEH"
     MRITFVLAAV LAFSPLCVAY TQADSLDDTL DAPHRTSAEK ARDSYRHPAK TLRFFNVEAD        60
     MAVVEIWPGS KGWYTAILAP YLRDNGTYYA AQFPPDSNIP FYQRSLIQFK TRLAKQDEIY       120
     NKVRITHLYP PVYNDIAPAG TVDRVLTFRN VHNWAKSGKG EAAFKSFYKA LKPGGVLGVV       180
     EHRAPEVRPL ERQIETGYMS EGYVIALAEK AGFTLVDRSE INANPKDQIN HPAGVWTLPP       240
     TLRLGDKDRE TYEAIGESDR MTLKFLKPEH                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page