(data stored in ACNUC7421 zone)

EMBL: AM286690.PE498

AM286690.PE498       Location/Qualifiers
FT   CDS             548268..548456
FT                   /transl_table=11
FT                   /locus_tag="ABO_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15946"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSA2"
FT                   /protein_id="CAL15946.1"
FT                   /translation="MMAIKIAFDECKGWKSCEGLVYSRPTARVVELVDTTDSKSVAFTG
FT                   VPVQVRPLVPNNKKARF"
     MMAIKIAFDE CKGWKSCEGL VYSRPTARVV ELVDTTDSKS VAFTGVPVQV RPLVPNNKKA        60
     RF                                                                       62
//

If you have problems or comments...

PBIL Back to PBIL home page