(data stored in ACNUC7421 zone)

EMBL: AM286690.PE507

AM286690.PE507       Location/Qualifiers
FT   CDS             complement(556757..558178)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0507"
FT                   /product="amidase family protein"
FT                   /EC_number="6.3.5.-"
FT                   /note="carbon-nitrogen ligase with glutamine as
FT                   amido-N-donor, amidase family protein identified by
FT                   sequencesimilarity; putative InterPro: Amidase"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15955"
FT                   /db_xref="GOA:Q0VS93"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS93"
FT                   /protein_id="CAL15955.1"
FT                   /translation="MSKELLTMSAQALKAAYQAGALSPVEVCNTLLDHIERHDEALNAW
FT                   CLIDRDTTLQWARDAEQRYQNGTAEGLLDGVPVAVKDVFLTPMWPTLKGSKTIDPASTL
FT                   EKRSPAVAALERHGYVPLGKTTTPEFGWKGITDSPLCGPTNNPWDPSKTSGGSSGGSAA
FT                   AVSAGMVPLALGTDAGGSIRIPAGFCGIVGHKPTFSEVPHWPASPFGTLAHAGPMTRSV
FT                   ADAALMMTVMSEADARDSLAAPRRGIDYVAALQQPMKGLRIALSTTLGYVDVNPEIEKA
FT                   TREAARVFESLGATVSEVDPGFSNPLAAFSHLFYSGAANAMRDLGERQRSLMDPALVEV
FT                   ASKAEKLSMLDYLGAMNERMAVSERMALFHTKYDLLITPCLPIEAFDTNREVPVDWPST
FT                   RWPTWTPFTYPFNMTGQPALSVPLGLSSNGLPMALQIVGARFDDARVLAAGHAFEQAQP
FT                   FVHLPPLLDELLKGA"
     MSKELLTMSA QALKAAYQAG ALSPVEVCNT LLDHIERHDE ALNAWCLIDR DTTLQWARDA        60
     EQRYQNGTAE GLLDGVPVAV KDVFLTPMWP TLKGSKTIDP ASTLEKRSPA VAALERHGYV       120
     PLGKTTTPEF GWKGITDSPL CGPTNNPWDP SKTSGGSSGG SAAAVSAGMV PLALGTDAGG       180
     SIRIPAGFCG IVGHKPTFSE VPHWPASPFG TLAHAGPMTR SVADAALMMT VMSEADARDS       240
     LAAPRRGIDY VAALQQPMKG LRIALSTTLG YVDVNPEIEK ATREAARVFE SLGATVSEVD       300
     PGFSNPLAAF SHLFYSGAAN AMRDLGERQR SLMDPALVEV ASKAEKLSML DYLGAMNERM       360
     AVSERMALFH TKYDLLITPC LPIEAFDTNR EVPVDWPSTR WPTWTPFTYP FNMTGQPALS       420
     VPLGLSSNGL PMALQIVGAR FDDARVLAAG HAFEQAQPFV HLPPLLDELL KGA              473
//

If you have problems or comments...

PBIL Back to PBIL home page