(data stored in ACNUC7421 zone)

EMBL: AM286690.PE515

AM286690.PE515       Location/Qualifiers
FT   CDS             complement(566468..567559)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0515"
FT                   /product="GTP-binding protein YchF"
FT                   /note="Function unclear"
FT                   /note="GTP-binding protein putative identified by match to
FT                   TIGR protein family HMMTIGR00650 InterPro: conserved
FT                   hypothetical protein 92"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15963"
FT                   /db_xref="GOA:Q0VS85"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS85"
FT                   /inference="protein motif:HMMTIGR:HMMTIGR00650"
FT                   /protein_id="CAL15963.1"
FT                   /translation="MGFKCGIVGLPNVGKSTLFNALTKAGIDAENFPFCTIEPNTGVVP
FT                   VPDPRLDKLEAIVNPERVLPATMEFVDIAGLVAGASKGEGLGNKFLANIRETDAIAHVV
FT                   RCFDDENVIHVSGKVSPLDDIAVINTELALADLDTVEKAHFRATKAAKGQDKDAKGLLP
FT                   VLDKVLPALNEGDPARSVELTDDERKAIKSLNLLTLKPTMYIANVDEGGFEDNALLDAV
FT                   RDLAEKENSSVVPICAKIESEIAELDDEEKADFLADLGMEEPGLNRVIRAGFDLLGLQT
FT                   YFTAGVKEVRAWTVRVGATAPQAAGVIHTDFEKGFIRAEVTGYEDYIANNGEQGAKEAG
FT                   KWRLEGKEYIVKDGDVVHFRFNV"
     MGFKCGIVGL PNVGKSTLFN ALTKAGIDAE NFPFCTIEPN TGVVPVPDPR LDKLEAIVNP        60
     ERVLPATMEF VDIAGLVAGA SKGEGLGNKF LANIRETDAI AHVVRCFDDE NVIHVSGKVS       120
     PLDDIAVINT ELALADLDTV EKAHFRATKA AKGQDKDAKG LLPVLDKVLP ALNEGDPARS       180
     VELTDDERKA IKSLNLLTLK PTMYIANVDE GGFEDNALLD AVRDLAEKEN SSVVPICAKI       240
     ESEIAELDDE EKADFLADLG MEEPGLNRVI RAGFDLLGLQ TYFTAGVKEV RAWTVRVGAT       300
     APQAAGVIHT DFEKGFIRAE VTGYEDYIAN NGEQGAKEAG KWRLEGKEYI VKDGDVVHFR       360
     FNV                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page